3.3 sec in total
358 ms
2.7 sec
217 ms
Visit ewellnessmarketplace.lavinaplatform.com now to see the best up-to-date Ewellnessmarketplace Lavinaplatform content and also check out these interesting facts you probably never knew about ewellnessmarketplace.lavinaplatform.com
Visit ewellnessmarketplace.lavinaplatform.comWe analyzed Ewellnessmarketplace.lavinaplatform.com page load time and found that the first response time was 358 ms and then it took 3 sec to load all DOM resources and completely render a web page. This is a poor result, as 50% of websites can load faster. This domain responded with an error, which can significantly jeopardize Ewellnessmarketplace.lavinaplatform.com rating and web reputation
ewellnessmarketplace.lavinaplatform.com performance score
358 ms
736 ms
413 ms
745 ms
161 ms
Our browser made a total of 29 requests to load all elements on the main page. We found that 3% of them (1 request) were addressed to the original Ewellnessmarketplace.lavinaplatform.com, 66% (19 requests) were made to S3-eu-west-1.amazonaws.com and 31% (9 requests) were made to Ewellnessmarketplace.com. The less responsive or slowest element that took the longest time to load (909 ms) relates to the external source S3-eu-west-1.amazonaws.com.
Page size can be reduced by 438.3 kB (29%)
1.5 MB
1.1 MB
In fact, the total size of Ewellnessmarketplace.lavinaplatform.com main page is 1.5 MB. This result falls beyond the top 1M of websites and identifies a large and not optimized web page that may take ages to load. 25% of websites need less resources to load. Images take 1.0 MB which makes up the majority of the site volume.
Potential reduce by 14.6 kB
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. This page needs HTML code to be minified as it can gain 3.5 kB, which is 20% of the original size. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 14.6 kB or 83% of the original size.
Potential reduce by 50.0 kB
Image size optimization can help to speed up a website loading time. The chart above shows the difference between the size before and after optimization. Ewellnessmarketplace Lavinaplatform images are well optimized though.
Potential reduce by 253.7 kB
It’s better to minify JavaScript in order to improve website performance. The diagram shows the current total size of all JavaScript files against the prospective JavaScript size after its minification and compression. It is highly recommended that all JavaScript files should be compressed and minified as it can save up to 253.7 kB or 71% of the original size.
Potential reduce by 120.0 kB
CSS files minification is very important to reduce a web page rendering time. The faster CSS files can load, the earlier a page can be rendered. Ewellnessmarketplace.lavinaplatform.com needs all CSS files to be minified and compressed as it can save up to 120.0 kB or 83% of the original size.
We found no issues to fix!
26
26
The browser has sent 26 CSS, Javascripts, AJAX and image requests in order to completely render the main page of Ewellnessmarketplace Lavinaplatform. According to our analytics all requests are already optimized.
{{url}}
{{time}} ms
ewellnessmarketplace.lavinaplatform.com SEO score
EN
EN
UTF-8
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Ewellnessmarketplace.lavinaplatform.com can be misinterpreted by Google and other search engines. Our service has detected that English is used on the page, and it matches the claimed language. Our system also found out that Ewellnessmarketplace.lavinaplatform.com main page’s claimed encoding is utf-8. Use of this encoding format is the best practice as the main page visitors from all over the world won’t have any issues with symbol transcription.
{{og_description}}
ewellnessmarketplace.lavinaplatform.com
Open Graph description is not detected on the main page of Ewellnessmarketplace Lavinaplatform. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: