4 sec in total
1.2 sec
2.5 sec
291 ms
Welcome to mississippiriver.laketravisinformation.com homepage info - get ready to check Mississippiriver Laketravisinformation best content right away, or after learning these important things about mississippiriver.laketravisinformation.com
The page You have requested not found
Visit mississippiriver.laketravisinformation.comWe analyzed Mississippiriver.laketravisinformation.com page load time and found that the first response time was 1.2 sec and then it took 2.8 sec to load all DOM resources and completely render a web page. This is a poor result, as 50% of websites can load faster. This domain responded with an error, which can significantly jeopardize Mississippiriver.laketravisinformation.com rating and web reputation
mississippiriver.laketravisinformation.com performance score
name
value
score
weighting
Value1.5 s
96/100
10%
Value1.5 s
100/100
25%
Value1.5 s
100/100
10%
Value0 ms
100/100
30%
Value0.032
100/100
15%
Value1.5 s
100/100
10%
1216 ms
49 ms
75 ms
81 ms
89 ms
Our browser made a total of 32 requests to load all elements on the main page. We found that 91% of them (29 requests) were addressed to the original Mississippiriver.laketravisinformation.com, 6% (2 requests) were made to Lakestrong.com and 3% (1 request) were made to Google.com. The less responsive or slowest element that took the longest time to load (1.2 sec) belongs to the original domain Mississippiriver.laketravisinformation.com.
Page size can be reduced by 223.9 kB (48%)
466.8 kB
243.0 kB
In fact, the total size of Mississippiriver.laketravisinformation.com main page is 466.8 kB. This result falls beyond the top 1M of websites and identifies a large and not optimized web page that may take ages to load. 25% of websites need less resources to load. Javascripts take 231.2 kB which makes up the majority of the site volume.
Potential reduce by 19.2 kB
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. This page needs HTML code to be minified as it can gain 3.5 kB, which is 15% of the original size. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 19.2 kB or 82% of the original size.
Potential reduce by 7.2 kB
Image size optimization can help to speed up a website loading time. The chart above shows the difference between the size before and after optimization. Mississippiriver Laketravisinformation images are well optimized though.
Potential reduce by 162.2 kB
It’s better to minify JavaScript in order to improve website performance. The diagram shows the current total size of all JavaScript files against the prospective JavaScript size after its minification and compression. It is highly recommended that all JavaScript files should be compressed and minified as it can save up to 162.2 kB or 70% of the original size.
Potential reduce by 35.3 kB
CSS files minification is very important to reduce a web page rendering time. The faster CSS files can load, the earlier a page can be rendered. Mississippiriver.laketravisinformation.com needs all CSS files to be minified and compressed as it can save up to 35.3 kB or 83% of the original size.
Number of requests can be reduced by 13 (43%)
30
17
The browser has sent 30 CSS, Javascripts, AJAX and image requests in order to completely render the main page of Mississippiriver Laketravisinformation. We recommend that multiple CSS and JavaScript files should be merged into one by each type, as it can help reduce assets requests from 11 to 1 for JavaScripts and from 4 to 1 for CSS and as a result speed up the page load time.
{{url}}
{{time}} ms
mississippiriver.laketravisinformation.com accessibility score
Contrast
These are opportunities to improve the legibility of your content.
Impact
Issue
Background and foreground colors do not have a sufficient contrast ratio.
Internationalization and localization
These are opportunities to improve the interpretation of your content by users in different locales.
Impact
Issue
<html> element does not have a [lang] attribute
Best practices
These items highlight common accessibility best practices.
Impact
Issue
[user-scalable="no"] is used in the <meta name="viewport"> element or the [maximum-scale] attribute is less than 5.
mississippiriver.laketravisinformation.com best practices score
Trust and Safety
Impact
Issue
Does not use HTTPS
Ensure CSP is effective against XSS attacks
mississippiriver.laketravisinformation.com SEO score
Crawling and Indexing
To appear in search results, crawlers need access to your app.
Impact
Issue
robots.txt is not valid
Mobile Friendly
Make sure your pages are mobile friendly so users don’t have to pinch or zoom in order to read the content pages. [Learn more](https://developers.google.com/search/mobile-sites/).
Impact
Issue
Document uses legible font sizes
N/A
N/A
UTF-8
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Mississippiriver.laketravisinformation.com can be misinterpreted by Google and other search engines. Unfortunately we cannot identify language used on the page (probably there is a mix of languages, too little text or something else) and no language is claimed in <html> or <meta> tags either. Our system also found out that Mississippiriver.laketravisinformation.com main page’s claimed encoding is utf-8. Use of this encoding format is the best practice as the main page visitors from all over the world won’t have any issues with symbol transcription.
{{og_description}}
mississippiriver.laketravisinformation.com
Open Graph description is not detected on the main page of Mississippiriver Laketravisinformation. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: