1.4 sec in total
254 ms
1 sec
123 ms
Welcome to slclawnservice.manageandpaymyaccount.com homepage info - get ready to check Slclawnservice Manageandpaymyaccount best content for United States right away, or after learning these important things about slclawnservice.manageandpaymyaccount.com
Visit slclawnservice.manageandpaymyaccount.comWe analyzed Slclawnservice.manageandpaymyaccount.com page load time and found that the first response time was 254 ms and then it took 1.1 sec to load all DOM resources and completely render a web page. This is quite a good result, as only 20% of websites can load faster.
slclawnservice.manageandpaymyaccount.com performance score
name
value
score
weighting
Value1.8 s
90/100
10%
Value3.4 s
67/100
25%
Value2.4 s
98/100
10%
Value630 ms
47/100
30%
Value0.291
41/100
15%
Value8.9 s
34/100
10%
254 ms
69 ms
130 ms
196 ms
157 ms
Our browser made a total of 22 requests to load all elements on the main page. We found that 82% of them (18 requests) were addressed to the original Slclawnservice.manageandpaymyaccount.com, 9% (2 requests) were made to Seal.godaddy.com and 5% (1 request) were made to My.serviceautopilot.com. The less responsive or slowest element that took the longest time to load (435 ms) belongs to the original domain Slclawnservice.manageandpaymyaccount.com.
Page size can be reduced by 28.1 kB (57%)
49.4 kB
21.3 kB
In fact, the total size of Slclawnservice.manageandpaymyaccount.com main page is 49.4 kB. This result falls beyond the top 1M of websites and identifies a large and not optimized web page that may take ages to load. 20% of websites need less resources to load. HTML takes 40.5 kB which makes up the majority of the site volume.
Potential reduce by 28.1 kB
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. HTML code on this page is well minified. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 28.1 kB or 69% of the original size.
Potential reduce by 0 B
It’s better to minify JavaScript in order to improve website performance. The diagram shows the current total size of all JavaScript files against the prospective JavaScript size after its minification and compression. This website has mostly compressed JavaScripts.
Number of requests can be reduced by 11 (52%)
21
10
The browser has sent 21 CSS, Javascripts, AJAX and image requests in order to completely render the main page of Slclawnservice Manageandpaymyaccount. We recommend that multiple CSS and JavaScript files should be merged into one by each type, as it can help reduce assets requests from 5 to 1 for JavaScripts and from 8 to 1 for CSS and as a result speed up the page load time.
{{url}}
{{time}} ms
slclawnservice.manageandpaymyaccount.com accessibility score
Contrast
These are opportunities to improve the legibility of your content.
Impact
Issue
Background and foreground colors do not have a sufficient contrast ratio.
Best practices
These items highlight common accessibility best practices.
Impact
Issue
[user-scalable="no"] is used in the <meta name="viewport"> element or the [maximum-scale] attribute is less than 5.
slclawnservice.manageandpaymyaccount.com best practices score
Trust and Safety
Impact
Issue
Does not use HTTPS
Ensure CSP is effective against XSS attacks
User Experience
Impact
Issue
Serves images with low resolution
General
Impact
Issue
Missing source maps for large first-party JavaScript
slclawnservice.manageandpaymyaccount.com SEO score
Mobile Friendly
Make sure your pages are mobile friendly so users don’t have to pinch or zoom in order to read the content pages. [Learn more](https://developers.google.com/search/mobile-sites/).
Impact
Issue
Document uses legible font sizes
N/A
N/A
UTF-8
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Slclawnservice.manageandpaymyaccount.com can be misinterpreted by Google and other search engines. Unfortunately we cannot identify language used on the page (probably there is a mix of languages, too little text or something else) and no language is claimed in <html> or <meta> tags either. Our system also found out that Slclawnservice.manageandpaymyaccount.com main page’s claimed encoding is utf-8. Use of this encoding format is the best practice as the main page visitors from all over the world won’t have any issues with symbol transcription.
{{og_description}}
slclawnservice.manageandpaymyaccount.com
Open Graph description is not detected on the main page of Slclawnservice Manageandpaymyaccount. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: