10.2 sec in total
3.2 sec
6.6 sec
390 ms
Welcome to wealthmakerfinancialservices.com.au homepage info - get ready to check Wealth Maker Financial Services best content right away, or after learning these important things about wealthmakerfinancialservices.com.au
WealthMaker are expert mortgage brokers & financial planners that provide clients with personalised home loan and financial and retirement solutions.
Visit wealthmakerfinancialservices.com.auWe analyzed Wealthmakerfinancialservices.com.au page load time and found that the first response time was 3.2 sec and then it took 7 sec to load all DOM resources and completely render a web page. This is a poor result, as 80% of websites can load faster.
wealthmakerfinancialservices.com.au performance score
name
value
score
weighting
Value2.9 s
53/100
10%
Value2.9 s
80/100
25%
Value7.8 s
23/100
10%
Value40 ms
100/100
30%
Value0.107
88/100
15%
Value4.7 s
80/100
10%
3241 ms
710 ms
473 ms
483 ms
475 ms
Our browser made a total of 56 requests to load all elements on the main page. We found that 96% of them (54 requests) were addressed to the original Wealthmakerfinancialservices.com.au, 4% (2 requests) were made to Google-analytics.com. The less responsive or slowest element that took the longest time to load (3.2 sec) belongs to the original domain Wealthmakerfinancialservices.com.au.
Page size can be reduced by 432.7 kB (19%)
2.3 MB
1.9 MB
In fact, the total size of Wealthmakerfinancialservices.com.au main page is 2.3 MB. This result falls beyond the top 1M of websites and identifies a large and not optimized web page that may take ages to load. 40% of websites need less resources to load. Images take 2.0 MB which makes up the majority of the site volume.
Potential reduce by 34.5 kB
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. This page needs HTML code to be minified as it can gain 9.2 kB, which is 22% of the original size. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 34.5 kB or 84% of the original size.
Potential reduce by 199.9 kB
Image size optimization can help to speed up a website loading time. The chart above shows the difference between the size before and after optimization. Wealth Maker Financial Services images are well optimized though.
Potential reduce by 162.4 kB
It’s better to minify JavaScript in order to improve website performance. The diagram shows the current total size of all JavaScript files against the prospective JavaScript size after its minification and compression. It is highly recommended that all JavaScript files should be compressed and minified as it can save up to 162.4 kB or 62% of the original size.
Potential reduce by 35.9 kB
CSS files minification is very important to reduce a web page rendering time. The faster CSS files can load, the earlier a page can be rendered. Wealthmakerfinancialservices.com.au needs all CSS files to be minified and compressed as it can save up to 35.9 kB or 84% of the original size.
Number of requests can be reduced by 21 (38%)
55
34
The browser has sent 55 CSS, Javascripts, AJAX and image requests in order to completely render the main page of Wealth Maker Financial Services. We recommend that multiple CSS and JavaScript files should be merged into one by each type, as it can help reduce assets requests from 11 to 1 for JavaScripts and from 4 to 1 for CSS and as a result speed up the page load time.
{{url}}
{{time}} ms
wealthmakerfinancialservices.com.au accessibility score
Navigation
These are opportunities to improve keyboard navigation in your application.
Impact
Issue
Heading elements are not in a sequentially-descending order
Internationalization and localization
These are opportunities to improve the interpretation of your content by users in different locales.
Impact
Issue
<html> element does not have a [lang] attribute
Names and labels
These are opportunities to improve the semantics of the controls in your application. This may enhance the experience for users of assistive technology, like a screen reader.
Impact
Issue
Image elements do not have [alt] attributes
Links do not have a discernible name
wealthmakerfinancialservices.com.au best practices score
Trust and Safety
Impact
Issue
Does not use HTTPS
Includes front-end JavaScript libraries with known security vulnerabilities
Ensure CSP is effective against XSS attacks
User Experience
Impact
Issue
Displays images with incorrect aspect ratio
Serves images with low resolution
General
Impact
Issue
Detected JavaScript libraries
wealthmakerfinancialservices.com.au SEO score
Content Best Practices
Format your HTML in a way that enables crawlers to better understand your app’s content.
Impact
Issue
Links do not have descriptive text
Image elements do not have [alt] attributes
Crawling and Indexing
To appear in search results, crawlers need access to your app.
Impact
Issue
Links are not crawlable
Mobile Friendly
Make sure your pages are mobile friendly so users don’t have to pinch or zoom in order to read the content pages. [Learn more](https://developers.google.com/search/mobile-sites/).
Impact
Issue
Document uses legible font sizes
Tap targets are not sized appropriately
EN
N/A
UTF-8
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Wealthmakerfinancialservices.com.au can be misinterpreted by Google and other search engines. Our service has detected that English is used on the page, and neither this language nor any other was claimed in <html> or <meta> tags. Our system also found out that Wealthmakerfinancialservices.com.au main page’s claimed encoding is utf-8. Use of this encoding format is the best practice as the main page visitors from all over the world won’t have any issues with symbol transcription.
{{og_description}}
wealthmakerfinancialservices.com.au
Open Graph description is not detected on the main page of Wealth Maker Financial Services. Lack of Open Graph description can be counter-productive for their social media presence, as such a description allows converting a website homepage (or other pages) into good-looking, rich and well-structured posts, when it is being shared on Facebook and other social media. For example, adding the following code snippet into HTML <head> tag will help to represent this web page correctly in social networks: