22 sec in total
35 ms
21.3 sec
694 ms
Visit youhavemetmeataverystrangetimeinmylife.wordpress.com now to see the best up-to-date You Have Met Me At A Very Strange Time In My Life Wordp Re Ss content for United States and also check out these interesting facts you probably never knew about youhavemetmeataverystrangetimeinmylife.wordpress.com
because everyone is boring..and because you're different
Visit youhavemetmeataverystrangetimeinmylife.wordpress.comWe analyzed Youhavemetmeataverystrangetimeinmylife.wordpress.com page load time and found that the first response time was 35 ms and then it took 22 sec to load all DOM resources and completely render a web page. This is an excellent result, as only a small number of websites can load faster. Unfortunately, there was 1 request timeout, which can generally increase the web page load time, as the browser stays idle while waiting for website response.
youhavemetmeataverystrangetimeinmylife.wordpress.com performance score
name
value
score
weighting
Value2.8 s
58/100
10%
Value4.0 s
49/100
25%
Value2.8 s
96/100
10%
Value120 ms
97/100
30%
Value0.349
32/100
15%
Value5.5 s
71/100
10%
35 ms
914 ms
114 ms
111 ms
119 ms
Our browser made a total of 87 requests to load all elements on the main page. We found that 3% of them (3 requests) were addressed to the original Youhavemetmeataverystrangetimeinmylife.wordpress.com, 10% (9 requests) were made to S1.wp.com and 8% (7 requests) were made to S2.wp.com. The less responsive or slowest element that took the longest time to load (914 ms) belongs to the original domain Youhavemetmeataverystrangetimeinmylife.wordpress.com.
Page size can be reduced by 701.5 kB (48%)
1.5 MB
760.6 kB
In fact, the total size of Youhavemetmeataverystrangetimeinmylife.wordpress.com main page is 1.5 MB. This result falls beyond the top 1M of websites and identifies a large and not optimized web page that may take ages to load. 65% of websites need less resources to load. Javascripts take 746.5 kB which makes up the majority of the site volume.
Potential reduce by 65.5 kB
HTML content can be minified and compressed by a website’s server. The most efficient way is to compress content using GZIP which reduces data amount travelling through the network between server and browser. HTML code on this page is well minified. It is highly recommended that content of this web page should be compressed using GZIP, as it can save up to 65.5 kB or 78% of the original size.
Potential reduce by 44.8 kB
Image size optimization can help to speed up a website loading time. The chart above shows the difference between the size before and after optimization. You Have Met Me At A Very Strange Time In My Life Wordp Re Ss images are well optimized though.
Potential reduce by 550.9 kB
It’s better to minify JavaScript in order to improve website performance. The diagram shows the current total size of all JavaScript files against the prospective JavaScript size after its minification and compression. It is highly recommended that all JavaScript files should be compressed and minified as it can save up to 550.9 kB or 74% of the original size.
Potential reduce by 40.3 kB
CSS files minification is very important to reduce a web page rendering time. The faster CSS files can load, the earlier a page can be rendered. Youhavemetmeataverystrangetimeinmylife.wordpress.com needs all CSS files to be minified and compressed as it can save up to 40.3 kB or 76% of the original size.
Number of requests can be reduced by 42 (56%)
75
33
The browser has sent 75 CSS, Javascripts, AJAX and image requests in order to completely render the main page of You Have Met Me At A Very Strange Time In My Life Wordp Re Ss. We recommend that multiple CSS and JavaScript files should be merged into one by each type, as it can help reduce assets requests from 20 to 1 for JavaScripts and from 11 to 1 for CSS and as a result speed up the page load time.
{{url}}
{{time}} ms
youhavemetmeataverystrangetimeinmylife.wordpress.com accessibility score
Contrast
These are opportunities to improve the legibility of your content.
Impact
Issue
Background and foreground colors do not have a sufficient contrast ratio.
Names and labels
These are opportunities to improve the semantics of the controls in your application. This may enhance the experience for users of assistive technology, like a screen reader.
Impact
Issue
Links do not have a discernible name
youhavemetmeataverystrangetimeinmylife.wordpress.com best practices score
Trust and Safety
Impact
Issue
Does not use HTTPS
Ensure CSP is effective against XSS attacks
General
Impact
Issue
Detected JavaScript libraries
youhavemetmeataverystrangetimeinmylife.wordpress.com SEO score
Crawling and Indexing
To appear in search results, crawlers need access to your app.
Impact
Issue
Links are not crawlable
Mobile Friendly
Make sure your pages are mobile friendly so users don’t have to pinch or zoom in order to read the content pages. [Learn more](https://developers.google.com/search/mobile-sites/).
Impact
Issue
Document uses legible font sizes
EN
EN
UTF-8
Language claimed in HTML meta tag should match the language actually used on the web page. Otherwise Youhavemetmeataverystrangetimeinmylife.wordpress.com can be misinterpreted by Google and other search engines. Our service has detected that English is used on the page, and it matches the claimed language. Our system also found out that Youhavemetmeataverystrangetimeinmylife.wordpress.com main page’s claimed encoding is utf-8. Use of this encoding format is the best practice as the main page visitors from all over the world won’t have any issues with symbol transcription.
{{og_description}}
youhavemetmeataverystrangetimeinmylife.wordpress.com
Open Graph data is detected on the main page of You Have Met Me At A Very Strange Time In My Life Wordp Re Ss. This is the best way to make the web page social media friendly. Here is how it looks like on Facebook: